Structure of PDB 6b0q Chain D Binding Site BS02

Receptor Information
>6b0q Chain D (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSD
QLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSC
QKKFARSDELVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b0q Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites.
Resolution2.794 Å
Binding residue
(original residue number in PDB)		K371 D396 K399 S425
Binding residue
(residue number reindexed from 1)		K53 D78 K81 S107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6b0q, PDBe:6b0q, PDBj:6b0q
PDBsum6b0q
PubMed29294058
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]