Structure of PDB 6ah3 Chain D Binding Site BS02

Receptor Information
>6ah3 Chain D (length=203) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DYQRINKNSKIALREYINNCKKNTKKCLKLAYENKITDKEDLLHYIEEKH
PTIYESLPQYVDFVPMYKELWINYIKELLNITKNLKTFNGSLALLKLSMA
DYNGALLRVTKSKNKTLIGLQGIVIWDSQKFFIMIVKGNIIDEIKCIPKK
GTVFQFEIPISDDDDSALRYSILGDRFKYRSVDRAGRKFKSRRCDDMLYY
IQN
Ligand information
>6ah3 Chain T (length=80) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaagcggauuuagcucaguugggagagcgccagacugaagaucuggagg
uccuguguucgauccacagaauucgcauuu
....<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>...
..<<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ah3 Structural insight into precursor tRNA processing by yeast ribonuclease P.
Resolution3.48 Å
Binding residue
(original residue number in PDB)		Y255 R263 K266
Binding residue
(residue number reindexed from 1)		Y179 R187 K190
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000171 ribonuclease MRP activity
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0033204 ribonuclease P RNA binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0034965 intronic box C/D snoRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:0030677 ribonuclease P complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ah3, PDBe:6ah3, PDBj:6ah3
PDBsum6ah3
PubMed30262633
UniProtP38336|POP4_YEAST RNases MRP/P 32.9 kDa subunit (Gene Name=POP4)

[Back to BioLiP]