Structure of PDB 5xxb Chain D Binding Site BS02

Receptor Information
>5xxb Chain D (length=261) Species: 5811 (Toxoplasma gondii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKALKNKAYFKRYQVKYRRRRQGKTDYAARRALVLQDRNKYNAHKHRLVV
RLTNKRIICQVVYSTIEGDRVLATAESTELPRYGVKIGLTNYAAAYCTGL
LLARRVLKQLGMSETFEGVETGEEYHIEENFGERRPFKVLLDVGIVRTTV
GNRVFGAMKGAADGGLHVPHGIKKFPGYSYDPEAHRARILGLHVADYMRQ
LKEEDPEKYSAQFSQYIKNKIEADDIEAMYKNAHAQIRKNPDAVRHVKLT
KAQRRERVQQK
Ligand information
>5xxb Chain 3 (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcugucggucauacugcgucgaauacaccggaucccuucagaccuccgaa
uuaagcggcgcaaggcccgguuaguacuugggugggggacucccagggaa
uaccgggugcugacagcu
<<<<<<<<.....<<<<<<<<.....<.<<<..............>>>..
>....>>>>>>.>><<<<<<<.....<<<<<<.<<....>>>>>>>>...
.>>>>>>>.>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xxb Cryo-EM structures of the 80S ribosomes from human parasites Trichomonas vaginalis and Toxoplasma gondii
Resolution3.17 Å
Binding residue
(original residue number in PDB)		K8 K10 F13 K14 Y16 V18 Y20 R21 R22 R24 K27 T28 Y30 R33 R54 T56 N57 K58 R59 I61 Q63 E70 D72 V74 N94 Y95 R151 N156 R157 R201 H206 Y210 Q213 F226 S227 Q228 Y229 V257 R283 V285 K286 L287 K289 R292 R295
Binding residue
(residue number reindexed from 1)		K5 K7 F10 K11 Y13 V15 Y17 R18 R19 R21 K24 T25 Y27 R30 R51 T53 N54 K55 R56 I58 Q60 E67 D69 V71 N91 Y92 R147 N152 R153 R188 H193 Y197 Q200 F213 S214 Q215 Y216 V244 R245 V247 K248 L249 K251 R254 R257
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Apr 30 04:16:15 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5xxb', asym_id = 'D', bs = 'BS02', title = 'Cryo-EM structures of the 80S ribosomes from hum...sites Trichomonas vaginalis and Toxoplasma gondii'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5xxb', asym_id='D', bs='BS02', title='Cryo-EM structures of the 80S ribosomes from hum...sites Trichomonas vaginalis and Toxoplasma gondii')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '5xxb', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='5xxb', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>