Structure of PDB 5xvp Chain D Binding Site BS02

Receptor Information
>5xvp Chain D (length=288) Species: 749498 (Enterococcus faecalis TX0027) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGWRTVVVNKHSKLSYKNNHLVFKAIDHQELIHLSEIDVLLLETTDISLT
TMLLKRLIDEKILVLFCDDKRLPIGKILPFYGRHDSSLQLTRQLAWTEER
KGQVWTAIIAQKITNQSLHLAQRDYGQKAAALLAMRAELRLFDPANREGH
AARSYFNTLFGNDFTREQENDINAGLNYGYTLLLSIFARELVQTGCFTQL
GLKHANQFNDFNLASDLMEPFRPLVDQIIYENRKEAFPIMKRKLFALFMN
TYMYKKKQMFLTNIATDYTKHVVKVLNQEEEGVPEFGI
Ligand information
>5xvp Chain H (length=71) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgtagctgaggcctcagctacgttccgttttagagtcatgttgtttagaa
tggtaccaaaacctcggagaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5xvp How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
K70 R71 R166 A174 N177 Y178 Y180 L182 H204 A205 N206 Q207 F208 N209 R222 F237 K241
Binding residue
(residue number reindexed from 1)
K70 R71 R166 A174 N177 Y178 Y180 L182 H204 A205 N206 Q207 F208 N209 R222 F237 K241
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 09:22:06 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5xvp', asym_id = 'D', bs = 'BS02', title = 'How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5xvp', asym_id='D', bs='BS02', title='How type II CRISPR-Cas establish immunity through Cas1-Cas2-mediated spacer integration.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0004519,0004520,0043571,0046872,0051607', uniprot = '', pdbid = '5xvp', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0004519,0004520,0043571,0046872,0051607', uniprot='', pdbid='5xvp', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>