Structure of PDB 5w3v Chain D Binding Site BS02

Receptor Information
>5w3v Chain D (length=183) Species: 9545 (Macaca nemestrina) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALLTAKTFSLQFNNKRRVNKPYYPRKALLCYQLTPQNGSTPTRGHLINKK
EDHAEIRFINEIKSMGLDETQDYQVTCYLTWSPCPSCAGELVDFIKAHRH
LNLRIFASRLYYHWHPNYQEGLLLLCGSQVPVEVMGLPEFTDCWENFVDH
KEPPSFNPSEKLKELDKNSQAIKRRLERIKSRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w3v APOBEC3H structure reveals an unusual mechanism of interaction with duplex RNA.
Resolution2.243 Å
Binding residue
(original residue number in PDB)		R17 R18 N20 K21 Y23 H114 W115 R175 R176
Binding residue
(residue number reindexed from 1)		R16 R17 N19 K20 Y22 H113 W114 R174 R175
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003824 catalytic activity
GO:0004126 cytidine deaminase activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0016554 cytidine to uridine editing
GO:0045087 innate immune response
GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
GO:0051607 defense response to virus
GO:0070383 DNA cytosine deamination
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5w3v, PDBe:5w3v, PDBj:5w3v
PDBsum5w3v
PubMed29044109
UniProtA0A1B2AH37

[Back to BioLiP]