Structure of PDB 5w2m Chain D Binding Site BS02

Receptor Information

>5w2m Chain D (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFR
NQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAE
FLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYC
WENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE

Ligand information

>5w2m Chain N (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tttttttttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5w2m Molecular Interactions of a DNA Modifying Enzyme APOBEC3F Catalytic Domain with a Single-Stranded DNA.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	K352 K355
Binding residue (residue number reindexed from 1)	K163 K166
Binding affinity	PDBbind-CN: Kd=6.36uM

Enzymatic activity

Enzyme Commision number

3.5.4.38: single-stranded DNA cytosine deaminase.

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0008270	zinc ion binding
GO:0016787	hydrolase activity

View graph for
Molecular Function

External links

PDB	RCSB:5w2m, PDBe:5w2m, PDBj:5w2m
PDBsum	5w2m
PubMed	29191651
UniProt	Q8IUX4\|ABC3F_HUMAN DNA dC->dU-editing enzyme APOBEC-3F (Gene Name=APOBEC3F)

[Back to BioLiP]