Structure of PDB 5t0u Chain D Binding Site BS02

Receptor Information
>5t0u Chain D (length=169) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRY
KHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYK
LKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCD
TVIARKSDLGVHLRKQHSY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t0u Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution3.199 Å
Binding residue
(original residue number in PDB)		R301 T315 F331 E336 R339 H340 Y343 K344 Y358 E362 K365 R368 H369 S372 R377 Y386 R389 K393 R396 H397 K405 F416 T417 Q418 T421 H425 I446 R448 D451
Binding residue
(residue number reindexed from 1)		R8 T22 F38 E43 R46 H47 Y50 K51 Y65 E69 K72 R75 H76 S79 R84 Y93 R96 K100 R103 H104 K112 F123 T124 Q125 T128 H132 I153 R155 D158
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5t0u, PDBe:5t0u, PDBj:5t0u
PDBsum5t0u
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]