Structure of PDB 5t00 Chain D Binding Site BS02

Receptor Information
>5t00 Chain D (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIR
SHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGT
MKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t00 Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution2.19 Å
Binding residue
(original residue number in PDB)		F331 E336 R339 H340 Y343 K344 E362 K365 R368 S372 R377 Y386 R389 K393 R396 H397 T400 K405 F416 T417 Q418 T421 H425 K429 T444 I446 R448 D451
Binding residue
(residue number reindexed from 1)		F10 E15 R18 H19 Y22 K23 E41 K44 R47 S51 R56 Y65 R68 K72 R75 H76 T79 K84 F95 T96 Q97 T100 H104 K108 T123 I125 R127 D130
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5t00, PDBe:5t00, PDBj:5t00
PDBsum5t00
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]