Structure of PDB 5nl0 Chain D Binding Site BS02

Receptor Information
>5nl0 Chain D (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>5nl0 Chain J (length=193) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tacgtaatattggccagctaggatatcacaatcccggtgccgaggccgct
caattggtcgtagacagctctagcaccgcttaaacgcacgtacggattcc
gtacgtgcgtttaagcggtgctagagctgtctacgaccaattgagcggcc
tcggcaccgggattgtgatatcctagctggccaatattacgta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nl0 Structure and Dynamics of a 197 bp Nucleosome in Complex with Linker Histone H1.
Resolution5.4 Å
Binding residue
(original residue number in PDB)		R27 K28 R30 I36 Y37
Binding residue
(residue number reindexed from 1)		R1 K2 R4 I10 Y11
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5nl0, PDBe:5nl0, PDBj:5nl0
PDBsum5nl0
PubMed28475873
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]