Structure of PDB 5nbc Chain D Binding Site BS02

Receptor Information

>5nbc Chain D (length=124) Species: 263 (Francisella tularensis)

VTQPRVEILKLFEKNKDKHLSPDDVFSKLKAQGSTTGIATVYRVLNQFES
AGIINRLKLDNEQVMYELNQGEHHDHIICVKCNMIQEFYSPGIEALQKQI
VESFGAEMIDYSLNIYVKCKSCRE

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 5nbc Chain D Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5nbc Structural and functional studies of the metalloregulator Fur identify a promoter-binding mechanism and its role inFrancisella tularensisvirulence.
• Resolution: 1.699 Å
• Binding residue (original residue number in PDB): C93 C96 C133 C136
• Binding residue (residue number reindexed from 1): C79 C82 C119 C122
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:1900705 negative regulation of siderophore biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5nbc, PDBe:5nbc, PDBj:5nbc
• PDBsum: 5nbc
• PubMed: 30271974
• UniProt: Q5NIN6