Structure of PDB 5msm Chain D Binding Site BS02

Receptor Information
>5msm Chain D (length=370) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SINLHSAPEYDPSYKLIQLTPELLDIIQDPHQLRFKSLDKDKSEVVLCSH
DKTWVLKQRKHSNTVLLMREFVPEQPITFDETLLFGLSKPYMDVVGFAKT
ESEFETRETHGELNLNSVPIYNGELDFSDKIMKRSSTKVIGTLEELLENS
PCSALEGISKWHKIGGSVKDGVLCILSQDFLFKALHVLLMSAMAESLDLQ
HLNVEDTHHAVGKDIEDEFNPYTREIIETVLNKFAVQEQNTWRLRIPFIA
QWYGIQALRKYVSGISMPIDEFLIKWKSLFPPFFPCDIDIDMLRGYHFKP
TDKTVQYIAKSTLPMDPKERFKVLFRLQSQWDLEDIKPLIEESRGMKIDS
FIMKYARRKRLGKKTVVTSR
Ligand information
>5msm Chain F (length=26) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKIWVKYNEGFSNAVRKNVTWNNLWE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5msm Structural studies of RFC(C)(tf18) reveal a novel chromatin recruitment role for Dcc1.
Resolution2.29 Å
Binding residue
(original residue number in PDB)		S41 K44 D45 S47 V49 L60 K61 Q62 R63 K64 H65 S66 N67 F108
Binding residue
(residue number reindexed from 1)		S37 K40 D41 S43 V45 L56 K57 Q58 R59 K60 H61 S62 N63 F104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0007064 mitotic sister chromatid cohesion
GO:0034088 maintenance of mitotic sister chromatid cohesion
GO:0034398 telomere tethering at nuclear periphery
GO:0035753 maintenance of DNA trinucleotide repeats
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000785 chromatin
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5msm, PDBe:5msm, PDBj:5msm
PDBsum5msm
PubMed28188145
UniProtP25559|DCC1_YEAST Sister chromatid cohesion protein DCC1 (Gene Name=DCC1)

[Back to BioLiP]