Structure of PDB 5mmi Chain D Binding Site BS02

Receptor Information

>5mmi Chain D (length=221) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SVDAGIGVMGTKLGMMSFFEEDGTVVPVTVIGFKEGNIVTQVKTESTDGY
NAVQVGYERLRDRKLTMPERGHLNKAGVIPMRHLQEFRLVSVDDFTPSQK
LLFEELFKEGDMVDISGTTIGKGFQGGIKRHNFKRGLMTHGSKSHRALGS
IGAGTTPGHVYKGKKMPGRMGGTKTKIRKLKIMKIDTDLRVVMIKGAVPG
KPGNLLRLAPAKIVGKNIPKN

Ligand information

>5mmi Chain W (length=106) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agagaaggucacggcgagacgagccguuuaucauuacgauaggugucaag
uggaagugcagugauguaugcagcugaggcauccuaacagacccacagac
uugaac

......<<<<<<<<<.......>>>>>............<<<<<<<<.<<
<....<<<<<....>>>>>...>>>..>>>>>.>>>...>>>>.......
......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mmi The complete structure of the chloroplast 70S ribosome in complex with translation factor pY.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	E119 R143 L144 R145 K148 T150 M151 R166 G205 G207 F208 R253 R274 P286
Binding residue (residue number reindexed from 1)	E35 R59 L60 R61 K64 T66 M67 R82 G121 G123 F124 R169 R190 P202

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0009507	chloroplast
GO:0009941	chloroplast envelope
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mmi, PDBe:5mmi, PDBj:5mmi
PDBsum	5mmi
PubMed	28007896
UniProt	P82191\|RK3_SPIOL Large ribosomal subunit protein uL3c (Gene Name=RPL3)

[Back to BioLiP]