Structure of PDB 5kl4 Chain D Binding Site BS02

Receptor Information
>5kl4 Chain D (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPYQCDFKDCERRFSRSDHLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKT
HTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kl4 Denys-Drash syndrome associated WT1 glutamine 369 mutants have altered sequence-preferences and altered responses to epigenetic modifications.
Resolution1.783 Å
Binding residue
(original residue number in PDB)		R366 D396 K399 S425
Binding residue
(residue number reindexed from 1)		R16 D46 K49 S75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5kl4, PDBe:5kl4, PDBj:5kl4
PDBsum5kl4
PubMed27596598
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]