Structure of PDB 5kkq Chain D Binding Site BS02

Receptor Information
>5kkq Chain D (length=145) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHI
RSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kkq Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution1.744 Å
Binding residue
(original residue number in PDB)		F331 E336 R339 H340 Y343 K344 Y358 E362 K365 R368 H369 S372 R377 Y386 R389 K393 R396 H397 T400 K405 F416 Q418 T421 H425 K429 A447 R448 D451
Binding residue
(residue number reindexed from 1)		F11 E16 R19 H20 Y23 K24 Y38 E42 K45 R48 H49 S52 R57 Y66 R69 K73 R76 H77 T80 K85 F96 Q98 T101 H105 K109 A127 R128 D131
Binding affinityPDBbind-CN: Kd=9nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5kkq, PDBe:5kkq, PDBj:5kkq
PDBsum5kkq
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]