Structure of PDB 5jvh Chain D Binding Site BS02

Receptor Information
>5jvh Chain D (length=177) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKEDSKAIDK
AAKELALITLQKPIITKAKKSISNFKLRQGMPVGIKVTLRGERMYVFLEK
LINIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFPEITYDMVDKTRGM
DITIVTTAKTDEEARALLQSMGLPFRK
Ligand information
>5jvh Chain Y (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acccccgugcccauagcacuguggaaccaccccaccccaugccgaacugg
gucgugaaacacagcagcgccaaugauacucggaccgcagggucccggaa
aagucggucagcgcgggggu
<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>..
.....>>>..>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jvh Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
Resolution3.58 Å
Binding residue
(original residue number in PDB)		S24 M26 A27 Q63 K64 I66 K69 T90 R92
Binding residue
(residue number reindexed from 1)		S22 M24 A25 Q61 K62 I64 K67 T88 R90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jvh, PDBe:5jvh, PDBj:5jvh
PDBsum5jvh
PubMed27791159
UniProtQ9RXJ0|RL5_DEIRA Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]