Structure of PDB 5jlx Chain D Binding Site BS02

Receptor Information

>5jlx Chain D (length=58) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNR
RMKWKKEN

Ligand information

>5jlx Chain F (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tctctaatggctttc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5jlx Stereospecific Effects of Oxygen-to-Sulfur Substitution in DNA Phosphate on Ion Pair Dynamics and Protein-DNA Affinity.
Resolution	2.748 Å
Binding residue (original residue number in PDB)	R5 Q6 Y8 R43 I47 W48 N51
Binding residue (residue number reindexed from 1)	R3 Q4 Y6 R41 I45 W46 N49
Binding affinity	PDBbind-CN: Kd=7.3nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5jlx, PDBe:5jlx, PDBj:5jlx
PDBsum	5jlx
PubMed	27271797
UniProt	P02833\|ANTP_DROME Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]