Structure of PDB 5jlw Chain D Binding Site BS02

Receptor Information
>5jlw Chain D (length=57) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRR
MKWKKEN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jlw Stereospecific Effects of Oxygen-to-Sulfur Substitution in DNA Phosphate on Ion Pair Dynamics and Protein-DNA Affinity.
Resolution2.088 Å
Binding residue
(original residue number in PDB)		R5 Q6 Y8 R43 Q44 I47 N51 K55
Binding residue
(residue number reindexed from 1)		R2 Q3 Y5 R40 Q41 I44 N48 K52
Binding affinityPDBbind-CN: Kd=3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5jlw, PDBe:5jlw, PDBj:5jlw
PDBsum5jlw
PubMed27271797
UniProtP02833|ANTP_DROME Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]