Structure of PDB 5hyt Chain D Binding Site BS02

Receptor Information
>5hyt Chain D (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCN
SDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLI
GSTTSRCEVQDRGVGWSHPLPQCEI
Ligand information
>5hyt Chain C (length=28) Species: 1314 (Streptococcus pyogenes) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ISQESKLINTLTDENEKLREELQQYYAL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hyt Conserved patterns hidden within group A Streptococcus M protein hypervariability recognize human C4b-binding protein.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		T7 L8 L34 Y62 R66 H67 E70
Binding residue
(residue number reindexed from 1)		T8 L9 L35 Y63 R67 H68 E71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5hyt, PDBe:5hyt, PDBj:5hyt
PDBsum5hyt
PubMed27595425
UniProtP04003|C4BPA_HUMAN C4b-binding protein alpha chain (Gene Name=C4BPA)

[Back to BioLiP]