Structure of PDB 5ddq Chain D Binding Site BS02

Receptor Information
>5ddq Chain D (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMR
GQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIA
Ligand information
>5ddq Chain B (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cguugacccaggaaacugggcggaaguaagguccauugcacuccgggccu
gaagcaacgcg
<<<<<.<<<<<....>>>>>........<<<<<<..........>>>>>>
....>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ddq Structural and Dynamic Basis for Low-Affinity, High-Selectivity Binding of L-Glutamine by the Glutamine Riboswitch.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R6 T88
Binding residue
(residue number reindexed from 1)		R5 T87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5ddq, PDBe:5ddq, PDBj:5ddq
PDBsum5ddq
PubMed26655897
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]