Structure of PDB 5d5v Chain D Binding Site BS02

Receptor Information
>5d5v Chain D (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFK
HNNMASFVRQLNMYGFRKVVHIEQGGVKPERDDTEFQHPCFLRGQEQLLE
NIKRKVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5d5v Structure of human heat-shock transcription factor 1 in complex with DNA.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		K62 H63 N65 S68 Q72 Y76 R117
Binding residue
(residue number reindexed from 1)		K50 H51 N53 S56 Q60 Y64 R104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5d5v, PDBe:5d5v, PDBj:5d5v
PDBsum5d5v
PubMed26727489
UniProtQ00613|HSF1_HUMAN Heat shock factor protein 1 (Gene Name=HSF1)

[Back to BioLiP]