Structure of PDB 5brm Chain D Binding Site BS02

Receptor Information
>5brm Chain D (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWKCSA
PKYIDYLMTWVQDQLDDETLFPFPKNFMSVAKTILKRLFRVYAHIYHQHF
DSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5brm Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
Resolution2.651 Å
Binding residue
(original residue number in PDB)
A58 V59 V62 F65 N66 N69 L126 D127
Binding residue
(residue number reindexed from 1)
A7 V8 V11 F14 N15 N18 L65 D66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5brm, PDBe:5brm, PDBj:5brm
PDBsum5brm
PubMed26108669
UniProtQ9H8S9|MOB1A_HUMAN MOB kinase activator 1A (Gene Name=MOB1A)

[Back to BioLiP]