Structure of PDB 5bpd Chain D Binding Site BS02

Receptor Information

>5bpd Chain D (length=260) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSKDRMVELLQEHFELNLYEARAYVALVAFGVLTPAELASVSEVPAPRTY
DVLRSLEKKGFAMTQPGKTNKYRPVHPANVLEKFIQDWQERVKEELEAKK
KAKEELLELMAPLIETEKYGVERVWVVRGIKNSTLKTKEMLEEAQNEILL
ADDGFIAVNLEDDIIKAVDRGVKTKILLTKNLLPRLKASKIIDYAKEGKL
ELRALDKFDLPMLICDEEVFFALEDLAARYFNYETQVWIKDHRVVALFKE
KFNEYWEKAE

Ligand information

>5bpd Chain F (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tatatcactatcgatgatata

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5bpd Structural Insights into Nonspecific Binding of DNA by TrmBL2, an Archaeal Chromatin Protein.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	Y50 R54 N70
Binding residue (residue number reindexed from 1)	Y50 R54 N70

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:5bpd, PDBe:5bpd, PDBj:5bpd
PDBsum	5bpd
PubMed	26299937
UniProt	Q8U3H1\|TMBL2_PYRFU Putative HTH-type transcriptional regulator TrmBL2 (Gene Name=trmBL2)

[Back to BioLiP]