Structure of PDB 4zqw Chain D Binding Site BS02

Receptor Information
>4zqw Chain D (length=167) Species: 478008 (Escherichia coli O157:H7 str. EC869) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFNKDQDYWANIFVTPDFLSVETYSGLGMTGRDPLFSPRLLQPDVDDKSL
GEEILQALSDSRTLDVLEERVAFFDLEKSKEQYAAWIATLMEKYGYRTKR
ALFKNMKKVGIHLVNDVITIRPSFHEKLEAWSGNRINESDYVVLPADSSP
TEIGSGLRLALSRCKGT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4zqw Diversification of beta-Augmentation Interactions between CDI Toxin/Immunity Proteins.
Resolution2.001 Å
Binding residue
(original residue number in PDB)
W10 N12 Y25 G29 M30 T31 G32 F75 S80 Y84 K109 R122 A131 W132 S133 G134 I137
Binding residue
(residue number reindexed from 1)
W9 N11 Y24 G28 M29 T30 G31 F74 S79 Y83 K108 R121 A130 W131 S132 G133 I136
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4zqw, PDBe:4zqw, PDBj:4zqw
PDBsum4zqw
PubMed26449640
UniProtB3BM81|CDII4_ECO5C Immunity protein CdiI-o11 (Gene Name=cdiI4)

[Back to BioLiP]