Structure of PDB 4z89 Chain D Binding Site BS02

Receptor Information
>4z89 Chain D (length=65) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGEL
RGRRGYVPHNMVSEV
Ligand information
>4z89 Chain d (length=12) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GRRLPPTPSKPS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z89 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
Resolution2.64 Å
Binding residue
(original residue number in PDB)		M1323 F1324 P1333 N1334 E1346 D1359 G1360 F1361 Y1372 P1374 H1375 N1376 M1377
Binding residue
(residue number reindexed from 1)		M7 F8 P17 N18 E30 D43 G44 F45 Y56 P58 H59 N60 M61
Enzymatic activity
Enzyme Commision number ?
External links