Structure of PDB 4yjl Chain D Binding Site BS02

Receptor Information
>4yjl Chain D (length=339) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHHHMLHLLEQIRAYCETCWEWQEAHEPGMDQDKNPMPAPVEHQICPA
VCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRR
YAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLR
NLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHC
TENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATN
EDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALW
DMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yjl Structures of the APC-ARM domain in complexes with discrete Amer1/WTX fragments reveal that it uses a consensus mode to recognize its binding partners
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R463 M503 T506 N507 F510 G511 K516 D539 Q542 V543 R549 N550 W553 S583 S590 W593 N594 A597 K603 R640 N641 W685 N686
Binding residue
(residue number reindexed from 1)		R64 M104 T107 N108 F111 G112 K117 D140 Q143 V144 R150 N151 W154 S184 S191 W194 N195 A198 K204 R241 N242 W286 N287
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008013 beta-catenin binding
Biological Process
GO:0030178 negative regulation of Wnt signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4yjl, PDBe:4yjl, PDBj:4yjl
PDBsum4yjl
PubMed27462415
UniProtP25054|APC_HUMAN Adenomatous polyposis coli protein (Gene Name=APC)

[Back to BioLiP]