Structure of PDB 4xid Chain D Binding Site BS02

Receptor Information
>4xid Chain D (length=56) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRM
KWKKEN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xid Entropic Enhancement of Protein-DNA Affinity by Oxygen-to-Sulfur Substitution in DNA Phosphate.
Resolution2.701 Å
Binding residue
(original residue number in PDB)		R5 Q6 Y8 I47 N51 K55
Binding residue
(residue number reindexed from 1)		R1 Q2 Y4 I43 N47 K51
Binding affinityPDBbind-CN: Kd=11nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4xid, PDBe:4xid, PDBj:4xid
PDBsum4xid
PubMed26331260
UniProtP02833|ANTP_DROME Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]