Structure of PDB 4xic Chain D Binding Site BS02

Receptor Information

>4xic Chain D (length=56) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRM
KWKKEN

Ligand information

>4xic Chain F (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tctctaatggctttc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4xic Entropic Enhancement of Protein-DNA Affinity by Oxygen-to-Sulfur Substitution in DNA Phosphate.
Resolution	2.69 Å
Binding residue (original residue number in PDB)	R5 Q6 Y8 Q44 I47 N51
Binding residue (residue number reindexed from 1)	R1 Q2 Y4 Q40 I43 N47
Binding affinity	PDBbind-CN: Kd=2.9nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4xic, PDBe:4xic, PDBj:4xic
PDBsum	4xic
PubMed	26331260
UniProt	P02833\|ANTP_DROME Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]