Structure of PDB 4wu9 Chain D Binding Site BS02

Receptor Information
>4wu9 Chain D (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>4wu9 Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgattcagctgaacatgccttttgatggagc
agtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wu9 Stereochemical control of nucleosome targeting by platinum-intercalator antitumor agents.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R30 K31 S33 I36 Y37
Binding residue
(residue number reindexed from 1)		R3 K4 S6 I9 Y10
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4wu9, PDBe:4wu9, PDBj:4wu9
PDBsum4wu9
PubMed25916851
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]