Structure of PDB 4wfa Chain D Binding Site BS02

Receptor Information
>4wfa Chain D (length=155) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAV
EELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLDKLI
SVSLPRVRDFQGVSKKAFDGRGNYTLGVDKVSKVRGMDIVIVTTANTDEE
ARELL
Ligand information
>4wfa Chain Y (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaaggucuuuagcgacgaugguagccaacuuacguuccgcuagagua
gaacguugccaggc
.<<.<..<.....<<<<<<<......<<<<<...............>>>.
.>>.....>>>>>.>><.........<.<............>.>......
...>..>..>.>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wfa Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
Resolution3.392 Å
Binding residue
(original residue number in PDB)		S24 M26 T61 G86
Binding residue
(residue number reindexed from 1)		S20 M22 T57 G82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wfa, PDBe:4wfa, PDBj:4wfa
PDBsum4wfa
PubMed26464510
UniProtQ2FW18|RL5_STAA8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]