Structure of PDB 4rdu Chain D Binding Site BS02

Receptor Information
>4rdu Chain D (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQ
NKRSKIKKIMKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rdu Crystal structure of a distal-less homeobox protein 5 (Dlx5) from Homo sapiens at 1.85 A resolution
Resolution1.85 Å
Binding residue
(original residue number in PDB)
R141 I143 Y161 Q186 R189
Binding residue
(residue number reindexed from 1)
R5 I7 Y25 Q50 R53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4rdu, PDBe:4rdu, PDBj:4rdu
PDBsum4rdu
PubMed
UniProtP56178|DLX5_HUMAN Homeobox protein DLX-5 (Gene Name=DLX5)

[Back to BioLiP]