Structure of PDB 4pu4 Chain D Binding Site BS02

Receptor Information
>4pu4 Chain D (length=78) Species: 211586 (Shewanella oneidensis MR-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVY
ISTVFKILDGLGIDIVSAQTSDTETNGW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pu4 The bacterial antitoxin HipB establishes a ternary complex with operator DNA and phosphorylated toxin HipA to regulate bacterial persistence.
Resolution3.786 Å
Binding residue
(original residue number in PDB)		V54 T55 T58 R61 D67 V68 Y69 T72
Binding residue
(residue number reindexed from 1)		V35 T36 T39 R42 D48 V49 Y50 T53
Binding affinityPDBbind-CN: Kd=5.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4pu4, PDBe:4pu4, PDBj:4pu4
PDBsum4pu4
PubMed25056321
UniProtQ8EIX4|HIPB_SHEON Antitoxin HipB (Gene Name=hipB)

[Back to BioLiP]