Structure of PDB 4pu3 Chain D Binding Site BS02

Receptor Information
>4pu3 Chain D (length=71) Species: 211586 (Shewanella oneidensis MR-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IMASPLNQQSLGLLIKERRKSAALTQDVAAMLCGVTKKTLIRVEKGEDVY
ISTVFKILDGLGIDIVSAGWY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pu3 The bacterial antitoxin HipB establishes a ternary complex with operator DNA and phosphorylated toxin HipA to regulate bacterial persistence.
Resolution3.39 Å
Binding residue
(original residue number in PDB)		T54 T57 R60 D66 V67 Y68 T71
Binding residue
(residue number reindexed from 1)		T36 T39 R42 D48 V49 Y50 T53
Binding affinityPDBbind-CN: Kd=5.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4pu3, PDBe:4pu3, PDBj:4pu3
PDBsum4pu3
PubMed25056321
UniProtQ8EIX4|HIPB_SHEON Antitoxin HipB (Gene Name=hipB)

[Back to BioLiP]