Structure of PDB 4pso Chain D Binding Site BS02

Receptor Information
>4pso Chain D (length=219) Species: 272557 (Aeropyrum pernix K1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMLPTLRTGLVIAAGYADKVRRVLFAQLRDAIKSGELSNKDVAMAAGNLN
RVLFELLVNKLKADKLDVVRIQIDYEVRDSQIQFDFSTLRVELWRRVPEE
EIAPIVEDFARAAPRLLEEEIRFTVEKVGETDVGDVVYRIMYRGSDVGAL
IVTPLNGEALVRGAVVEPTPLLLKRTRVQVEADRIDDFVRESVSRLFSEA
QNVEKREAVRVVNEILSLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pso Entrapment of DNA in an intersubunit tunnel system of a single-stranded DNA-binding protein.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
R5 K17 V21 A24 R27 K31 R204
Binding residue
(residue number reindexed from 1)
R7 K19 V23 A26 R29 K33 R206
Enzymatic activity
Enzyme Commision number ?
External links