Structure of PDB 4on0 Chain D Binding Site BS02

Receptor Information
>4on0 Chain D (length=97) Species: 380 (Sinorhizobium fredii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLS
QSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4on0 Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
V45 Q56 S57 S60 R67 Q79 T80 I81
Binding residue
(residue number reindexed from 1)
V40 Q51 S52 S55 R62 Q74 T75 I76
Binding affinityPDBbind-CN: Kd=0.36uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4on0, PDBe:4on0, PDBj:4on0
PDBsum4on0
PubMed24733893
UniProtQ83TD2

[Back to BioLiP]