Structure of PDB 4omy Chain D Binding Site BS02

Receptor Information
>4omy Chain D (length=97) Species: 380 (Sinorhizobium fredii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLS
QSALSQHLSKLRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4omy Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR.
Resolution3.062 Å
Binding residue
(original residue number in PDB)		N28 R31 L54 S55 S57 Q61 H62
Binding residue
(residue number reindexed from 1)		N23 R26 L49 S50 S52 Q56 H57
Binding affinityPDBbind-CN: Kd=0.43uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4omy, PDBe:4omy, PDBj:4omy
PDBsum4omy
PubMed24733893
UniProtQ83TD2

[Back to BioLiP]