Structure of PDB 4odm Chain D Binding Site BS02

Receptor Information
>4odm Chain D (length=150) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNP
MPLTVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHL
Ligand information
>4odm Chain K (length=14) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RYANPKMKPFIFGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4odm Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
R34 N35 L36 I37 E60 Y63 G64 Q90 Y92 P102 L103
Binding residue
(residue number reindexed from 1)
R34 N35 L36 I37 E60 Y63 G64 Q90 Y92 P102 L103
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
GO:0046872 metal ion binding
Biological Process
GO:0042026 protein refolding

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4odm, PDBe:4odm, PDBj:4odm
PDBsum4odm
PubMed27664121
UniProtQ5SLE7

[Back to BioLiP]