Structure of PDB 4g6a Chain D Binding Site BS02

Receptor Information
>4g6a Chain D (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELTLTQSPASLAVSLGQRATISCRASESVDGYGNSFLHWFQQKPGQPPKL
LIYLASNLNSGVPARFSGSGSRTDFTLTIDPVEADDAATYYCQQNNVDPW
TFGGGTKLEIKRAVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV
QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
THQGLSSPVTKSFNRGEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g6a Structure of Hepatitis C Virus Envelope Glycoprotein E2 Antigenic Site 412 to 423 in Complex with Antibody AP33.
Resolution2.501 Å
Binding residue
(original residue number in PDB)		S7 T20 S22 R24 G66 D70 T72
Binding residue
(residue number reindexed from 1)		S7 T20 S22 R24 G70 D74 T76
External links