Structure of PDB 4cz6 Chain D Binding Site BS02

Receptor Information
>4cz6 Chain D (length=33) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGSEEIFTLQVRGRERYEILKKLNDSLELSDVV
Ligand information
>4cz6 Chain C (length=27) Species: 7955 (Danio rerio) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EIFTLQVRGRERYEILKKLNDSLELSD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cz6 Tracing the Evolution of the P53 Tetramerization Domain
Resolution1.53 Å
Binding residue
(original residue number in PDB)		G299 S301 E303 I304 F305 T306 L307 Q308 V309 R310 G311 R312 R314 Y315 L318 N322 L325 E326 V331
Binding residue
(residue number reindexed from 1)		G1 S3 E5 I6 F7 T8 L9 Q10 V11 R12 G13 R14 R16 Y17 L20 N24 L27 E28 V33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051262 protein tetramerization

View graph for
Biological Process
External links
PDB RCSB:4cz6, PDBe:4cz6, PDBj:4cz6
PDBsum4cz6
PubMed25185827
UniProtP79734|P53_DANRE Cellular tumor antigen p53 (Gene Name=tp53)

[Back to BioLiP]