Structure of PDB 4c2d Chain D Binding Site BS02

Receptor Information
>4c2d Chain D (length=343) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SERDKAMDKIEKAYELISNEYVEKVDREKLLEGAIQGMLSTLNDPYSVYM
DKQTAKQFSDSLDLETVFASEKKVQGHSVGYIAISTFSEHTAEDFAKALR
ELEKKEIEGLVIDVRGNPGGYLQSVEEILKHFVTKDQPYIQIAERNGDKK
RYFSTLTHKKAYPVNVITDKGSASASEILAGALKEAGHYDVVGDTSFGKG
TVQQAVPMGDGSNIKLTLYKWLTPNGNWIHKKGIEPTIAIKQPDYFSAGP
LQLKEPLKVDMNNEDVKHAQVLLKGLSFDPGREDGYFSKDMKKAVMAFQD
QNKLNKTGVIDTRTAETLNQQIEKKKSDEKNDLQLQTALKSLF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4c2d Ctpb Assembles a Gated Protease Tunnel Regulating Cell-Cell Signaling During Spore Formation in Bacillus Subtilis.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
G254 G255 S309 A310 K334 K350
Binding residue
(residue number reindexed from 1)
G119 G120 S174 A175 K199 K215
Enzymatic activity
Enzyme Commision number 3.4.21.102: C-terminal processing peptidase.
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
GO:0042277 peptide binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006508 proteolysis
GO:0006518 peptide metabolic process
GO:0007165 signal transduction
GO:0030435 sporulation resulting in formation of a cellular spore
Cellular Component
GO:0030288 outer membrane-bounded periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4c2d, PDBe:4c2d, PDBj:4c2d
PDBsum4c2d
PubMed24243021
UniProtO35002|CTPB_BACSU Carboxy-terminal processing protease CtpB (Gene Name=ctpB)

[Back to BioLiP]