Structure of PDB 4bqa Chain D Binding Site BS02

Receptor Information
>4bqa Chain D (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKP
KMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4bqa Structural Insights Into the Autoregulation and Cooperativity of the Human Transcription Factor Ets-2.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q364 L365 W403 K407 M412 K416 Y423 Y424
Binding residue
(residue number reindexed from 1)		Q4 L5 W43 K47 M52 K56 Y63 Y64
Binding affinityPDBbind-CN: Kd=0.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4bqa, PDBe:4bqa, PDBj:4bqa
PDBsum4bqa
PubMed25670864
UniProtP15036|ETS2_HUMAN Protein C-ets-2 (Gene Name=ETS2)

[Back to BioLiP]