Structure of PDB 4a1w Chain D Binding Site BS02

Receptor Information
>4a1w Chain D (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESV
DKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG
Ligand information
>4a1w Chain S (length=18) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IWIAQELRRLGDEFNAYY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a1w Evaluation of Diverse Alpha/Beta-Backbone Patterns for Functional Alpha-Helix Mimicry: Analogues of the Bim Bh3 Domain.
Resolution2.497 Å
Binding residue
(original residue number in PDB)		F97 R100 Y101 Q111 L112 Q125 V126 E129 L130 D133 N136 G138 R139 Y195
Binding residue
(residue number reindexed from 1)		F42 R45 Y46 Q56 L57 Q70 V71 E74 L75 D78 N81 G83 R84 Y140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4a1w, PDBe:4a1w, PDBj:4a1w
PDBsum4a1w
PubMed22040025
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]