Structure of PDB 3x1t Chain D Binding Site BS02

Receptor Information
>3x1t Chain D (length=93) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Ligand information
>3x1t Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3x1t Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
Resolution2.808 Å
Binding residue
(original residue number in PDB)		R33 K34 E35 S36 I39 Y40
Binding residue
(residue number reindexed from 1)		R1 K2 E3 S4 I7 Y8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0042393 histone binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006337 nucleosome disassembly
GO:0006954 inflammatory response
GO:0031639 plasminogen activation
GO:0035092 sperm DNA condensation
GO:0051276 chromosome organization
GO:0071674 mononuclear cell migration
Cellular Component
GO:0000786 nucleosome
GO:0001674 female germ cell nucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0009986 cell surface

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3x1t, PDBe:3x1t, PDBj:3x1t
PDBsum3x1t
PubMed26188507
UniProtP70696|H2B1A_MOUSE Histone H2B type 1-A (Gene Name=H2bc1)

[Back to BioLiP]