Structure of PDB 3wkj Chain D Binding Site BS02

Receptor Information
>3wkj Chain D (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLA
HYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>3wkj Chain J (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcca
tcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggagc
agtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wkj Structure of human nucleosome containing the testis-specific histone variant TSH2B.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R34 K35 E36 S37 Y41
Binding residue
(residue number reindexed from 1)		R2 K3 E4 S5 Y9
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0042393 histone binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006337 nucleosome disassembly
GO:0006954 inflammatory response
GO:0031639 plasminogen activation
GO:0035092 sperm DNA condensation
GO:0051276 chromosome organization
GO:0071674 mononuclear cell migration
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0001674 female germ cell nucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0009986 cell surface

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wkj, PDBe:3wkj, PDBj:3wkj
PDBsum3wkj
PubMed24699735
UniProtQ96A08|H2B1A_HUMAN Histone H2B type 1-A (Gene Name=H2BC1)

[Back to BioLiP]