Structure of PDB 3u15 Chain D Binding Site BS02

Receptor Information

>3u15 Chain D (length=81) Species: 9606 (Homo sapiens)

QVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVY
CGGDLLGELLGRQSFSVKDPSPLYDMLRKNL

Ligand information

• Ligand ID: 03M
• InChI: InChI=1S/C20H14ClF2N3O2/c1-10-14(21)4-3-13-12(8-24-18(10)13)7-17-19(27)26(20(28)25-17)9-11-2-5-15(22)16(23)6-11/h2-8,24H,9H2,1H3,(H,25,28)/b17-7-
• InChIKey: OEXMEVPQEPHTAQ-IDUWFGFVSA-N
• SMILES:
  ACDLabs 12.01: Clc1ccc2c(c1C)ncc2/C=C3/C(=O)N(C(=O)N3)Cc4cc(F)c(F)cc4
  OpenEye OEToolkits 1.7.2: Cc1c(ccc2c1[nH]cc2C=C3C(=O)N(C(=O)N3)Cc4ccc(c(c4)F)F)Cl
  CACTVS 3.370: Cc1c(Cl)ccc2c(c[nH]c12)C=C3NC(=O)N(Cc4ccc(F)c(F)c4)C3=O
  CACTVS 3.370: Cc1c(Cl)ccc2c(c[nH]c12)\C=C3/NC(=O)N(Cc4ccc(F)c(F)c4)C3=O
  OpenEye OEToolkits 1.7.2: Cc1c(ccc2c1[nH]cc2/C=C\3/C(=O)N(C(=O)N3)Cc4ccc(c(c4)F)F)Cl
• Formula: C20 H14 Cl F2 N3 O2
• Name: (5Z)-5-[(6-chloro-7-methyl-1H-indol-3-yl)methylidene]-3-(3,4-difluorobenzyl)imidazolidine-2,4-dione
• ChEMBL: CHEMBL5267044
• ZINC: ZINC000098207755
• PDB chain: 3u15 Chain D Residue 1

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3u15 Activation of the p53 pathway by small-molecule-induced MDM2 and MDMX dimerization.
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): G57 I60 Y66 Q71
• Binding residue (residue number reindexed from 1): G32 I35 Y41 Q46
• Annotation score: 1
• Binding affinity: MOAD: Kd=0.078uM

Gene Ontology

Biological Process

• GO:0043066 negative regulation of apoptotic process
• GO:0051726 regulation of cell cycle

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:3u15, PDBe:3u15, PDBj:3u15
• PDBsum: 3u15
• PubMed: 22745160
• UniProt: O15151|MDM4_HUMAN Protein Mdm4 (Gene Name=MDM4)