Structure of PDB 3r93 Chain D Binding Site BS02

Receptor Information
>3r93 Chain D (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLE
FRKKIAENK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r93 Structural basis for specific binding of human MPP8 chromodomain to histone H3 methylated at lysine 9.
Resolution2.057 Å
Binding residue
(original residue number in PDB)
G82 Y83
Binding residue
(residue number reindexed from 1)
G27 Y28
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3r93, PDBe:3r93, PDBj:3r93
PDBsum3r93
PubMed22022377
UniProtQ99549|MPP8_HUMAN M-phase phosphoprotein 8 (Gene Name=MPHOSPH8)

[Back to BioLiP]