Structure of PDB 3qdz Chain D Binding Site BS02

Receptor Information

>3qdz Chain D (length=257) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRNI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTA
NVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDA
CEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWI
QKVIDQF

Ligand information

>3qdz Chain F (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PAPR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3qdz Molecular dissection of Na+ binding to thrombin.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	H57 W60D I174 D189 A190 E192 G193 S195 G216
Binding residue (residue number reindexed from 1)	H43 W50 I179 D199 A200 E202 G203 S205 G228

Enzymatic activity

Catalytic site (original residue number in PDB)	H57 N102 E192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1)	H43 N99 E202 G203 D204 S205 G206
Enzyme Commision number	3.4.21.5: thrombin.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0006508	proteolysis
GO:0007596	blood coagulation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3qdz, PDBe:3qdz, PDBj:3qdz
PDBsum	3qdz
PubMed
UniProt	P00734\|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]