Structure of PDB 3pio Chain D Binding Site BS02

Receptor Information

>3pio Chain D (length=177) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKEDSKAIDK
AAKELALITLQKPIITKAKKSISNFKLRQGMPVGIKVTLRGERMYVFLEK
LINIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFPEITYDMVDKTRGM
DITIVTTAKTDEEARALLQSMGLPFRK

Ligand information

>3pio Chain Y (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

acccccgugcccauagcacuguggaaccaccccaccccaugccgaacugg
gucgugaaacacagcagcgccaaugauacucggaccgcagggucccggaa
aagucggucagcgcgggggu

<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>..
.....>>>..>>>>>>>>>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3pio Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
Resolution	3.2473 Å
Binding residue (original residue number in PDB)	S24 M26 A27 R30 Q63 K64 I66 K88 T90 R92
Binding residue (residue number reindexed from 1)	S22 M24 A25 R28 Q61 K62 I64 K86 T88 R90

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3pio, PDBe:3pio, PDBj:3pio
PDBsum	3pio
PubMed	21282615
UniProt	Q9RXJ0\|RL5_DEIRA Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]