Structure of PDB 3osf Chain D Binding Site BS02

Receptor Information
>3osf Chain D (length=103) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKQKFTPEEDEMLKRAVAQHGSDWKMIAATFPNRNARQCRDRWKNYLAPS
ISHTPWTAEEDALLVQKIQEYGRQWAIIAKFFPGRTDIHIKNRWVTISNK
LGI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3osf Molecular basis of the recognition of the ap65-1 gene transcription promoter elements by a Myb protein from the protozoan parasite Trichomonas vaginalis.
Resolution2.032 Å
Binding residue
(original residue number in PDB)		K48 K49 K72 R87 K91 R120 W122 A123 K138
Binding residue
(residue number reindexed from 1)		K1 K2 K25 R40 K44 R73 W75 A76 K91
Binding affinityPDBbind-CN: Kd=32.3nM
Enzymatic activity
Enzyme Commision number ?
External links