Structure of PDB 3mth Chain D Binding Site BS02

Receptor Information
>3mth Chain D (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mth X-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben, and phenol.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Q4 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 P28 A30
Binding residue
(residue number reindexed from 1)		Q4 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 P28 A30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3mth, PDBe:3mth, PDBj:3mth
PDBsum3mth
PubMed7492558
UniProtP01315|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]