Structure of PDB 3ksb Chain D Binding Site BS02

Receptor Information

>3ksb Chain D (length=214) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAK
ADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTLLLT
FFYRYMRPLVEAGHVYIALPPLYKMSKKKEEVAYAWTDGELEELRKQFAT
LQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKV
EPRRKWIEDNVKFT

Ligand information

>3ksb Chain F (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgtgcatagtcattcatg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ksb Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
Resolution	3.5 Å
Binding residue (original residue number in PDB)	E433 G434 D435 S436 G457 K458
Binding residue (residue number reindexed from 1)	E19 G20 D21 S22 G43 K44

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3ksb, PDBe:3ksb, PDBj:3ksb
PDBsum	3ksb
PubMed	20596531
UniProt	Q59961\|PARE_STRPN DNA topoisomerase 4 subunit B (Gene Name=parE)

[Back to BioLiP]